PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019621P2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 363aa    MW: 40039.6 Da    PI: 9.151
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019621P2genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-333387155
         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  MELO3C019621P2 33 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 87
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3473090IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-323088IPR009057Homeodomain-like
SuperFamilySSF466891.67E-163288IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-233388IPR006447Myb domain, plants
PfamPF002491.1E-73585IPR001005SANT/Myb domain
PfamPF143794.8E-21129168IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MFHATKKPSS MTSHDRQMCV QGDSGLVLTT DPKPRLRWTV ELHERFVDAV TQLGGPDKAT  60
PKTIMRVMGV KGLTLYHLKS HLQKFRLGKQ PHKEFNDQSI KDGIRASALE LQRNSGSSST  120
LMDRSMNEMH MEVQRRLHEQ IEVQRHLQLR IEAQGKYMQS ILEKACQTLA GENMAAATAG  180
PFKTTSNNMG TTTSLVSDAA IKDFISPHHT FPPFQDMNNL FNSEPPPPPP PLIDCLKKPS  240
PFISGAGKTP IFWPDDLRLQ DLGTPSATLA PAPPPIGGAP DLDSLQLEMY ESKPPPPTPL  300
LAVGNNVMNE KKFDMTLKLE RPSPPRSGHS DERLNSNNNN NGMANNNNPT MLQPQGRNSS  360
FG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819210.0LN681921.1 Cucumis melo genomic scaffold, anchoredscaffold00039.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456284.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK51e-106APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0A0KAM10.0A0A0A0KAM1_CUCSA; Uncharacterized protein
STRINGGLYMA15G29620.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49643252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-106G2-like family protein